PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P00410_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 305aa    MW: 33462.4 Da    PI: 4.5597
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P00410_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.31.7e-102402722355
                            SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                            +yp++ee+++LA+k+gL+++q+ +WF N+R ++
  GSMUA_Achr2P00410_001 240 PYPTEEEKAKLAEKTGLEQKQINNWFINQRKRH 272
                            8*****************************885 PP

2ELK29.81.4e-10192213122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            +L+++L +KYsgyL++L++EF+
  GSMUA_Achr2P00410_001 192 DLREMLQKKYSGYLSNLRKEFL 213
                            69*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.8E-214690IPR005540KNOX1
PfamPF037906.6E-214887IPR005540KNOX1
SMARTSM012562.6E-2593144IPR005541KNOX2
PfamPF037913.0E-2396143IPR005541KNOX2
PROSITE profilePS5121310.755192212IPR005539ELK domain
PfamPF037898.8E-9192213IPR005539ELK domain
SMARTSM011885.3E-5192213IPR005539ELK domain
PROSITE profilePS5007113.086212275IPR001356Homeobox domain
SuperFamilySSF466891.15E-19214281IPR009057Homeodomain-like
SMARTSM003899.3E-14214279IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.3E-27217276IPR009057Homeodomain-like
CDDcd000863.70E-14224276No hitNo description
PfamPF059208.9E-18232271IPR008422Homeobox KN domain
PROSITE patternPS000270250273IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MEDLYSIHPG ILRGGDIPVI GSVSSCQVTN EASQVIGGGG GSDLTDMIKA QIANHPLYPS  60
LLSAYIECRK VGAPPEVAQL LEEIGSEGHS STGGGEIGAD PELDEFMESY CLALVRYKED  120
LSKPFDEAAS FLNDIEMQLT NLCKASSAAA TTTATGNSPS DEVIGTSEED QSCEDLESSE  180
GQEYGSRVAD SDLREMLQKK YSGYLSNLRK EFLKKRKKGK LPKDARLILL DWWNTHCRWP  240
YPTEEEKAKL AEKTGLEQKQ INNWFINQRK RHWKPSEDVR FALMEGVSDG SSGTMLCFGS  300
STTGT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1207216LRKEFLKKRK
2213217KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009379781.10.0PREDICTED: homeobox protein knotted-1-like 1 isoform X2
RefseqXP_009379773.10.0PREDICTED: homeobox protein knotted-1-like 1 isoform X2
RefseqXP_009379764.10.0PREDICTED: homeobox protein knotted-1-like 1 isoform X2
RefseqXP_009421490.10.0PREDICTED: homeobox protein knotted-1-like 1 isoform X1
SwissprotQ9FP291e-120KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLM0S3Y20.0M0S3Y2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P00410_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.12e-62KNOTTED1-like homeobox gene 6